SCOPe 2.07: Domain d3wu6e_: 3wu6 E:

Lineage for d3wu6e_ (3wu6 E:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families)

5. Family d.14.1.10: ATP-dependent protease Lon (La), catalytic domain [102769] (1 protein)
   contains extra C-terminal alpha/beta subdomain
   automatically mapped to Pfam PF05362

6. Protein ATP-dependent protease Lon (La), catalytic domain [102770] (2 species)

7. Species Escherichia coli [TaxId:562] [102771] (6 PDB entries)

8. Domain d3wu6e_: 3wu6 E: [261034]
   automated match to d1rree_
   complexed with so4

Details for d3wu6e_

PDB Entry: 3wu6, 1.8 Å

PDB Description: oxidized e.coli lon proteolytic domain

PDB Compounds: (E:) Lon protease

SCOPe Domain Sequences for d3wu6e_:

Sequence; same for both SEQRES and ATOM records:

>d3wu6e_ d.14.1.10 (E:) ATP-dependent protease Lon (La), catalytic domain {Escherichia coli [TaxId: 562]}
gradnenrvgqvtglawtevggdlltietacvpgkgkltytgslgevmqesiqaaltvvr
araeklginpdfyekrdihvhvpegatpkdgpaagiamctalvscltgnpvradvamtge
itlrgqvlpigglkekllaahrggiktvlipfenkrdleeipdnviadldihpvkrieev
ltlalqnepsgmqvvtak

Timeline for d3wu6e_:

• d3wu6e_ first appeared in SCOPe 2.04
  
• d3wu6e_ appears in SCOPe 2.06
  
• d3wu6e_ appears in the current release, SCOPe 2.08