SCOPe 2.04: Domain d4pkva2: 4pkv A:551-778

Lineage for d4pkva2 (4pkv A:551-778)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.14: Anthrax toxin lethal factor, N- and C-terminal domains [69775] (2 proteins)
   automatically mapped to Pfam PF07737

6. Protein automated matches [234341] (1 species)
   not a true protein

7. Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [234342] (4 PDB entries)

8. Domain d4pkva2: 4pkv A:551-778 [260941]
   Other proteins in same PDB: d4pkva1
   automated match to d1j7na2
   complexed with 30r, zn

Details for d4pkva2

PDB Entry: 4pkv, 2.5 Å

PDB Description: anthrax toxin lethal factor with bound small molecule inhibitor 16

PDB Compounds: (A:) Lethal Factor

SCOPe Domain Sequences for d4pkva2:

Sequence; same for both SEQRES and ATOM records:

>d4pkva2 d.92.1.14 (A:551-778) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
pkskidtkiqeaqlninqewnkalglpkytklitfnvhnryasnivesaylilnewknni
qsdlikkvtnylvdgngrfvftditlpniaeqythqdeiyeqvhskglyvpesrsillhg
pskgvelrndsegfihefghavddyagylldknqsdlvtnskkfidifkeegsnltsygr
tneaeffaeafrlmhstdhaerlkvqknapktfqfindqikfiinslv

Timeline for d4pkva2:

• d4pkva2 is new in SCOPe 2.04-stable
  
• d4pkva2 appears in SCOPe 2.05
  
• d4pkva2 appears in the current release, SCOPe 2.08