| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
| Protein automated matches [190069] (319 species) not a true protein |
| Species Mycobacterium smegmatis [TaxId:246196] [189539] (12 PDB entries) |
| Domain d4wecb_: 4wec B: [260851] Other proteins in same PDB: d4weca2, d4wecd2 automated match to d4bmnb_ complexed with edo, mg, nad, zn |
PDB Entry: 4wec (more details), 1.55 Å
SCOPe Domain Sequences for d4wecb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wecb_ c.2.1.0 (B:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
tqrlagkvavitggasgiglatgrrlraegatvvvgdidpttgkaaadeleglfvpvdvs
eqeavdnlfdtaastfgrvdiafnnagisppeddlientdlpawqrvqdinlksvylscr
aalrhmvpagkgsiintasfvavmgsatsqisytaskggvlamsrelgvqyarqgirvna
lcpgpvntpllqelfakdperaarrlvhiplgrfaepeelaaavaflasddasfitgstf
lvdggissayvtpl
Timeline for d4wecb_: