SCOPe 2.04: Domain d4r9mc_: 4r9m C:

Lineage for d4r9mc_ (4r9m C:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families)

5. Family d.108.1.0: automated matches [191308] (1 protein)
   not a true family

6. Protein automated matches [190038] (28 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [260781] (1 PDB entry)

8. Domain d4r9mc_: 4r9m C: [260783]
   automated match to d3eg7b_
   complexed with mg

Details for d4r9mc_

PDB Entry: 4r9m, 2.9 Å

PDB Description: crystal structure of spermidine n-acetyltransferase from escherichia coli

PDB Compounds: (C:) Spermidine N(1)-acetyltransferase

SCOPe Domain Sequences for d4r9mc_:

Sequence, based on SEQRES records:

>d4r9mc_ d.108.1.0 (C:) automated matches {Escherichia coli [TaxId: 83333]}
hsvklrpleredlryvhqldnnasvmrywfeepyeafvelsdlydkhihdqserrfvvec
dgekaglvelveinhvhrraefqiiispeyqgkglatraaklamdygftvlnlyklyliv
dkenekaihiyrklgfsvegelmheffingqyrnairmcifqhqylae

Sequence, based on observed residues (ATOM records):

>d4r9mc_ d.108.1.0 (C:) automated matches {Escherichia coli [TaxId: 83333]}
hsvklrpleredlryvhqldvmrywfeepyeafvelsdlydkhihdqserrfvvecdgek
aglvelveinhvhrraefqiiispeyqgkglatraaklamdygftvlnlyklylivdken
ekaihiyrklgfsvegelmheffingqyrnairmcifqhqylae

Timeline for d4r9mc_:

• d4r9mc_ is new in SCOPe 2.04-stable
  
• d4r9mc_ appears in SCOPe 2.05
  
• d4r9mc_ appears in the current release, SCOPe 2.08