Lineage for d4r17t_ (4r17 T:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1676433Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1676434Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1676603Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1678261Protein automated matches [190144] (7 species)
    not a true protein
  7. 1678524Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (31 PDB entries)
  8. 1678534Domain d4r17t_: 4r17 T: [260776]
    Other proteins in same PDB: d4r17s_
    automated match to d4g4sg_
    complexed with 3k4, mg

Details for d4r17t_

PDB Entry: 4r17 (more details), 2.1 Å

PDB Description: Ligand-induced aziridine-formation at subunit beta5 of the yeast 20S proteasome
PDB Compounds: (T:) Proteasome subunit alpha type-7

SCOPe Domain Sequences for d4r17t_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4r17t_ d.153.1.4 (T:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqknv
kiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqahtl
ynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhpe
glsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaqk
ein

SCOPe Domain Coordinates for d4r17t_:

Click to download the PDB-style file with coordinates for d4r17t_.
(The format of our PDB-style files is described here.)

Timeline for d4r17t_: