Lineage for d2hlcb_ (2hlc B:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
barrel, closed; n=6, S=8; greek-key
duplication: consists of two domains of the same foldSuperfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) 
Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) 
Protein HL collagenase [50529] (1 species) Species Common cattle grub (Hypoderma lineatum) [TaxId:7389] [50530] (2 PDB entries) 
Domain d2hlcb_: 2hlc B: [26075]
Details for d2hlcb_
PDB Entry: 2hlc (more details), 1.7 Å
PDB Description: hl collagenase structure at 1.7a resolution
PDB Compounds: (B:) collagenaseSCOPe Domain Sequences for d2hlcb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hlcb_ b.47.1.2 (B:) HL collagenase {Common cattle grub (Hypoderma lineatum) [TaxId: 7389]}
iingyeaytglfpyqaglditlqdqrrvwcggslidnkwiltaahcvhdavsvvvylgsa
vqyegeavvnseriishsmfnpdtylndvalikiphveytdniqpirlpsgeelnnkfen
iwatvsgwgqsntdtvilqytynlvidndrcaqeyppgiivesticgdtsdgkspcfgds
ggpfvlsdknlligvvsfvsgagcesgkpvgfsrvtsymdwiqqntgikf
SCOPe Domain Coordinates for d2hlcb_:
Click to download the PDB-style file with coordinates for d2hlcb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2hlcb_:
- d2hlcb_ first appeared (with stable ids) in SCOP 1.55
- d2hlcb_ appears in SCOPe 2.07
View in 3D
