Lineage for d2hlca_ (2hlc A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2404157Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2404158Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2404432Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2405206Protein HL collagenase [50529] (1 species)
  7. 2405207Species Common cattle grub (Hypoderma lineatum) [TaxId:7389] [50530] (2 PDB entries)
  8. 2405208Domain d2hlca_: 2hlc A: [26074]

Details for d2hlca_

PDB Entry: 2hlc (more details), 1.7 Å

PDB Description: hl collagenase structure at 1.7a resolution
PDB Compounds: (A:) collagenase

SCOPe Domain Sequences for d2hlca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hlca_ b.47.1.2 (A:) HL collagenase {Common cattle grub (Hypoderma lineatum) [TaxId: 7389]}
iingyeaytglfpyqaglditlqdqrrvwcggslidnkwiltaahcvhdavsvvvylgsa
vqyegeavvnseriishsmfnpdtylndvalikiphveytdniqpirlpsgeelnnkfen
iwatvsgwgqsntdtvilqytynlvidndrcaqeyppgiivesticgdtsdgkspcfgds
ggpfvlsdknlligvvsfvsgagcesgkpvgfsrvtsymdwiqqntgikf

SCOPe Domain Coordinates for d2hlca_:

Click to download the PDB-style file with coordinates for d2hlca_.
(The format of our PDB-style files is described here.)

Timeline for d2hlca_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2hlcb_