SCOPe 2.06: Domain d4o4gb_: 4o4g B:

Lineage for d4o4gb_ (4o4g B:)

1. Root: SCOPe 2.06

2. Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.2: Reverse transcriptase [56686] (3 proteins)

6. Protein HIV-1 reverse transcriptase [56689] (4 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [56690] (172 PDB entries)
   Uniprot P04585 159-692 # chain A coverage; chain B is shorter: 162-582 ! Uniprot P03366 186-725 # chain A coverage; chain B coverage: 156-584 ! Uniprot P04585 158-698 # chain A coverage; chain B is shorter: 159-595

8. Domain d4o4gb_: 4o4g B: [260717]
   Other proteins in same PDB: d4o4ga1, d4o4ga2, d4o4ga3
   automated match to d3is9b_
   complexed with 2rt

Details for d4o4gb_

PDB Entry: 4o4g, 2.71 Å

PDB Description: crystal structure of hiv-1 reverse transcriptase in complex with 4- ((4-(mesitylamino)-1,3,5-triazin-2-yl)amino)benzonitrile (jlj527), a non-nucleoside inhibitor

PDB Compounds: (B:) HIV-1 reverse transcriptase, p51 subunit

SCOPe Domain Sequences for d4o4gb_:

Sequence; same for both SEQRES and ATOM records:

>d4o4gb_ e.8.1.2 (B:) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1 [TaxId: 11676]}
pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdivi
yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlskllrgtkalteviplteeae
lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
plvklwyq

Timeline for d4o4gb_:

• d4o4gb_ first appeared in SCOPe 2.04
  
• d4o4gb_ appears in SCOPe 2.05
  
• d4o4gb_ appears in SCOPe 2.07
  
• d4o4gb_ appears in the current release, SCOPe 2.08