Class b: All beta proteins [48724] (180 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.3: Bacterial adhesins [49401] (7 families) |
Family b.2.3.2: Pilus subunits [49405] (11 proteins) |
Protein Mannose-specific adhesin FimH, N-terminal domain [418900] (2 species) protein duplication: consists of two domains of this fold; C-terminal domain lacks the last strand |
Species Escherichia coli [TaxId:562] [419300] (24 PDB entries) |
Domain d4ca4a_: 4ca4 A: [260647] automated match to d4atta_ complexed with kgm; mutant |
PDB Entry: 4ca4 (more details), 2.84 Å
SCOPe Domain Sequences for d4ca4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ca4a_ b.2.3.2 (A:) Mannose-specific adhesin FimH, N-terminal domain {Escherichia coli [TaxId: 562]} facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndapetitdyvtlqr gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai kagsliavlilrqtnnynsddfqfvwniyanndvvvpt
Timeline for d4ca4a_: