SCOPe 2.08: Domain d4ca4b_: 4ca4 B:

Lineage for d4ca4b_ (4ca4 B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (7 families)

5. Family b.2.3.2: Pilus subunits [49405] (11 proteins)

6. Protein Mannose-specific adhesin FimH, N-terminal domain [418900] (2 species)
   protein duplication: consists of two domains of this fold; C-terminal domain lacks the last strand

7. Species Escherichia coli [TaxId:562] [419300] (24 PDB entries)

8. Domain d4ca4b_: 4ca4 B: [260648]
   automated match to d4atta_
   complexed with kgm; mutant

Details for d4ca4b_

PDB Entry: 4ca4, 2.84 Å

PDB Description: crystal structure of fimh lectin domain with the tyr48ala mutation, in complex with heptyl alpha-d-mannopyrannoside

PDB Compounds: (B:) FimH

SCOPe Domain Sequences for d4ca4b_:

Sequence; same for both SEQRES and ATOM records:

>d4ca4b_ b.2.3.2 (B:) Mannose-specific adhesin FimH, N-terminal domain {Escherichia coli [TaxId: 562]}
facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndapetitdyvtlqr
gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvpt

Timeline for d4ca4b_:

• d4ca4b_ first appeared in SCOPe 2.04
  
• d4ca4b_ appears in SCOPe 2.07