Lineage for d4ca4b_ (4ca4 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2767438Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 2767443Family b.2.3.2: Pilus subunits [49405] (11 proteins)
  6. 2767497Protein Mannose-specific adhesin FimH, N-terminal domain [418900] (2 species)
    protein duplication: consists of two domains of this fold; C-terminal domain lacks the last strand
  7. 2767498Species Escherichia coli [TaxId:562] [419300] (24 PDB entries)
  8. 2767531Domain d4ca4b_: 4ca4 B: [260648]
    automated match to d4atta_
    complexed with kgm; mutant

Details for d4ca4b_

PDB Entry: 4ca4 (more details), 2.84 Å

PDB Description: crystal structure of fimh lectin domain with the tyr48ala mutation, in complex with heptyl alpha-d-mannopyrannoside
PDB Compounds: (B:) FimH

SCOPe Domain Sequences for d4ca4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ca4b_ b.2.3.2 (B:) Mannose-specific adhesin FimH, N-terminal domain {Escherichia coli [TaxId: 562]}
facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndapetitdyvtlqr
gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvpt

SCOPe Domain Coordinates for d4ca4b_:

Click to download the PDB-style file with coordinates for d4ca4b_.
(The format of our PDB-style files is described here.)

Timeline for d4ca4b_: