Lineage for d4qnwa_ (4qnw A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2436512Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2437126Family c.1.4.0: automated matches [191310] (1 protein)
    not a true family
  6. 2437127Protein automated matches [190048] (31 species)
    not a true protein
  7. 2437220Species Aspergillus fumigatus [TaxId:330879] [260575] (1 PDB entry)
  8. 2437221Domain d4qnwa_: 4qnw A: [260576]
    automated match to d1q45a_
    complexed with fmn, gol, so4

Details for d4qnwa_

PDB Entry: 4qnw (more details), 1.8 Å

PDB Description: Crystal structure of EasA, an old yellow enzyme from Aspergillus fumigatus
PDB Compounds: (A:) Chanoclavine-I aldehyde reductase

SCOPe Domain Sequences for d4qnwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qnwa_ c.1.4.0 (A:) automated matches {Aspergillus fumigatus [TaxId: 330879]}
aqlfkplkvgrchlqhrmimapttrfradgqgvplpfvqeyygqrasvpgtlliteatdi
tpkamgykhvpgiwsepqreawreivsrvhskkcfifcqlwatgraadpdvladmkdlis
ssavpveekgplpraltedeiqqciadfaqaarnainagfdgveihgangylidqftqks
cnhrqdrwggsienrarfavevtravieavgadrvgvklspysqylgmgtmdelvpqfey
liaqmrrldvaylhlansrwldeekphpdpnhevfvrvwgqsspillaggydaasaekvt
eqmaaatytnvaiafgryfistpdlpfrvmagiqlqkydrasfystlsregyldypfsae
ymalhnfpv

SCOPe Domain Coordinates for d4qnwa_:

Click to download the PDB-style file with coordinates for d4qnwa_.
(The format of our PDB-style files is described here.)

Timeline for d4qnwa_: