SCOPe 2.07: Domain d1ca0.1: 1ca0 A:,B:,C:

Lineage for d1ca0.1 (1ca0 A:,B:,C:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein (alpha,gamma)-chymotrypsin(ogen) [50522] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50523] (66 PDB entries)
   Uniprot P00766

8. Domain d1ca0.1: 1ca0 A:,B:,C: [26053]
   Other proteins in same PDB: d1ca0d_, d1ca0i_

Details for d1ca0.1

PDB Entry: 1ca0, 2.1 Å

PDB Description: bovine chymotrypsin complexed to appi

PDB Compounds: (A:) bovine chymotrypsin, (B:) bovine chymotrypsin, (C:) bovine chymotrypsin

SCOPe Domain Sequences for d1ca0.1:

Sequence; same for both SEQRES and ATOM records:

>g1ca0.1 b.47.1.2 (A:,B:,C:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
cgvpaiqpvlsXivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgvtts
dvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsavcl
psasddfaagttcvttgwgltryXantpdrlqqaslpllsntnckkywgtkikdamicag
asgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqqtlaa
n

Timeline for d1ca0.1:

• d1ca0.1 first appeared (with stable ids) in SCOP 1.55
  
• d1ca0.1 appears in SCOPe 2.06
  
• d1ca0.1 appears in the current release, SCOPe 2.08