SCOPe 2.08: Domain d1gmh.1: 1gmh E:,F:,G:

Lineage for d1gmh.1 (1gmh E:,F:,G:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein (alpha,gamma)-chymotrypsin(ogen) [50522] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50523] (66 PDB entries)
   Uniprot P00766

8. Domain d1gmh.1: 1gmh E:,F:,G: [26043]
   complexed with isp, so4

Details for d1gmh.1

PDB Entry: 1gmh, 2.1 Å

PDB Description: refined crystal structure of "aged" and "non-aged" organophosphoryl conjugates of gamma-chymotrypsin

PDB Compounds: (E:) gamma-chymotrypsin a, (F:) gamma-chymotrypsin a, (G:) gamma-chymotrypsin a

SCOPe Domain Sequences for d1gmh.1:

Sequence; same for both SEQRES and ATOM records:

>g1gmh.1 b.47.1.2 (E:,F:,G:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
cgvpaiqpvlXivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgvttsd
vvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsavclp
sasddfaagttcvttgwgltryXntpdrlqqaslpllsntnckkywgtkikdamicagas
gvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqqtlaan

Timeline for d1gmh.1:

• d1gmh.1 first appeared (with stable ids) in SCOP 1.55, called d1gmh__
  
• d1gmh.1 appears in SCOPe 2.07