![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
![]() | Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) ![]() N-terminal residue provides two catalytic groups, nucleophile and proton donor |
![]() | Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
![]() | Protein automated matches [190144] (7 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (31 PDB entries) |
![]() | Domain d4r17q_: 4r17 Q: [260396] Other proteins in same PDB: d4r17a_, d4r17e_, d4r17g_, d4r17i_, d4r17j_, d4r17k_, d4r17l_, d4r17n_, d4r17o_, d4r17u_, d4r17w_, d4r17x_, d4r17y_, d4r17z_ automated match to d1rypd_ complexed with 3k4, mg |
PDB Entry: 4r17 (more details), 2.1 Å
SCOPe Domain Sequences for d4r17q_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4r17q_ d.153.1.4 (Q:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe
Timeline for d4r17q_: