SCOPe 2.05: Domain d4q9oa_: 4q9o A:

Lineage for d4q9oa_ (4q9o A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.101: Undecaprenyl diphosphate synthase [64004] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 342156

4. Superfamily c.101.1: Undecaprenyl diphosphate synthase [64005] (2 families)
   the sheet topology is similar to those of the N-terminal domain of phosphoglycerate kinase and carbamate kinase

5. Family c.101.1.0: automated matches [191361] (1 protein)
   not a true family

6. Protein automated matches [190431] (4 species)
   not a true protein

7. Species Streptococcus pneumoniae [TaxId:171101] [260378] (2 PDB entries)

8. Domain d4q9oa_: 4q9o A: [260379]
   automated match to d4h8ea_
   complexed with 2zw, so4

Details for d4q9oa_

PDB Entry: 4q9o, 2.2 Å

PDB Description: Crystal structure of Upps + inhibitor

PDB Compounds: (A:) Isoprenyl transferase

SCOPe Domain Sequences for d4q9oa_:

Sequence; same for both SEQRES and ATOM records:

>d4q9oa_ c.101.1.0 (A:) automated matches {Streptococcus pneumoniae [TaxId: 171101]}
gsmavevevptqvpahigiimdgngrwakkrmqprvfghkagmealqtvtkaanklgvkv
itvyafstenwtrpdqevkfimnlpvefydnyvpelhannvkiqmigetdrlpkqtfeal
tkaeeltknntglilnfalnyggraeitqalklisqdvldakinpgditeelignylftq
hlpkdlrdpdliirtsgelrlsnflpwqgayselyftdtlwpdfdeaalqeailaynrrh

Timeline for d4q9oa_:

• d4q9oa_ first appeared in SCOPe 2.04
  
• d4q9oa_ is called d4q9oa1 in SCOPe 2.06
  
• d4q9oa_ appears in the current release, SCOPe 2.08, called d4q9oa1