Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.101: Undecaprenyl diphosphate synthase [64004] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 342156 |
Superfamily c.101.1: Undecaprenyl diphosphate synthase [64005] (2 families) the sheet topology is similar to those of the N-terminal domain of phosphoglycerate kinase and carbamate kinase |
Family c.101.1.0: automated matches [191361] (1 protein) not a true family |
Protein automated matches [190431] (4 species) not a true protein |
Species Streptococcus pneumoniae [TaxId:171101] [260378] (1 PDB entry) |
Domain d4q9oa_: 4q9o A: [260379] automated match to d4h8ea_ complexed with 2zw, so4 |
PDB Entry: 4q9o (more details), 2.2 Å
SCOPe Domain Sequences for d4q9oa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4q9oa_ c.101.1.0 (A:) automated matches {Streptococcus pneumoniae [TaxId: 171101]} gsmavevevptqvpahigiimdgngrwakkrmqprvfghkagmealqtvtkaanklgvkv itvyafstenwtrpdqevkfimnlpvefydnyvpelhannvkiqmigetdrlpkqtfeal tkaeeltknntglilnfalnyggraeitqalklisqdvldakinpgditeelignylftq hlpkdlrdpdliirtsgelrlsnflpwqgayselyftdtlwpdfdeaalqeailaynrrh
Timeline for d4q9oa_: