SCOPe 2.04: Domain d4ogfa_: 4ogf A:

Lineage for d4ogfa_ (4ogf A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures

5. Family c.23.16.2: DJ-1/PfpI [52325] (10 proteins)
   contains a catalytic triad or dyad different from the class I GAT triad

6. Protein DJ-1 [89603] (1 species)
   RNA-binding protein regulatory subunit

7. Species Human (Homo sapiens) [TaxId:9606] [89604] (35 PDB entries)
   Uniprot Q99497

8. Domain d4ogfa_: 4ogf A: [260344]
   automated match to d2r1va_

Details for d4ogfa_

PDB Entry: 4ogf, 1.6 Å

PDB Description: Crystal Structure of Human DJ-1 with glyoxylate as substrate analog

PDB Compounds: (A:) Protein DJ-1

SCOPe Domain Sequences for d4ogfa_:

Sequence; same for both SEQRES and ATOM records:

>d4ogfa_ c.23.16.2 (A:) DJ-1 {Human (Homo sapiens) [TaxId: 9606]}
askralvilakgaeemetvipvdvmrragikvtvaglagkdpvqcsrdvvicpdasleda
kkegpydvvvlpggnlgaqnlsesaavkeilkeqenrkgliaaixagptallaheigfgs
kvtthplakdkmmngghytysenrvekdgliltsrgpgtsfefalaivealngkevaaqv
kaplvlk

Timeline for d4ogfa_:

• d4ogfa_ is new in SCOPe 2.04-stable
  
• d4ogfa_ appears in SCOPe 2.05
  
• d4ogfa_ appears in the current release, SCOPe 2.08