Lineage for d2cgaa_ (2cga A:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 167857Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 167858Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 167950Family b.47.1.2: Eukaryotic proteases [50514] (38 proteins)
  6. 167951Protein (alpha,gamma)-chymotrypsin(ogen) [50522] (2 species)
  7. 167952Species Cow (Bos taurus) [TaxId:9913] [50523] (45 PDB entries)
  8. 167964Domain d2cgaa_: 2cga A: [26028]

Details for d2cgaa_

PDB Entry: 2cga (more details), 1.8 Å

PDB Description: bovine chymotrypsinogen a. x-ray crystal structure analysis and refinement of a new crystal form at 1.8 angstroms resolution

SCOP Domain Sequences for d2cgaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cgaa_ b.47.1.2 (A:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus)}
cgvpaiqpvlsglsrivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgv
ttsdvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsa
vclpsasddfaagttcvttgwgltrytnantpdrlqqaslpllsntnckkywgtkikdam
icagasgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqq
tlaan

SCOP Domain Coordinates for d2cgaa_:

Click to download the PDB-style file with coordinates for d2cgaa_.
(The format of our PDB-style files is described here.)

Timeline for d2cgaa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2cgab_