SCOPe 2.04: Domain d5cha.2: 5cha E:,F:,G:

Lineage for d5cha.2 (5cha E:,F:,G:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)

6. Protein (alpha,gamma)-chymotrypsin(ogen) [50522] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50523] (59 PDB entries)
   Uniprot P00766

8. Domain d5cha.2: 5cha E:,F:,G: [26026]

Details for d5cha.2

PDB Entry: 5cha, 1.67 Å

PDB Description: the refinement and the structure of the dimer of alpha-*chymotrypsin at 1.67-*angstroms resolution

PDB Compounds: (E:) alpha-chymotrypsin a, (F:) alpha-chymotrypsin a, (G:) alpha-chymotrypsin a

SCOPe Domain Sequences for d5cha.2:

Sequence; same for both SEQRES and ATOM records:

>g5cha.2 b.47.1.2 (E:,F:,G:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
cgvpaiqpvXivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgvttsdv
vvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsavclps
asddfaagttcvttgwgltryXantpdrlqqaslpllsntnckkywgtkikdamicagas
gvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqqtlaan

Timeline for d5cha.2:

• d5cha.2 first appeared (with stable ids) in SCOP 1.55, called d5chab_
  
• d5cha.2 appears in SCOPe 2.03
  
• d5cha.2 appears in SCOPe 2.05
  
• d5cha.2 appears in the current release, SCOPe 2.08