| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) ![]() |
| Family d.108.1.0: automated matches [191308] (1 protein) not a true family |
| Protein automated matches [190038] (48 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [225745] (54 PDB entries) |
| Domain d4c2yb2: 4c2y B:296-496 [260142] automated match to d3iu1a2 complexed with cit, gol, mg, mya |
PDB Entry: 4c2y (more details), 1.64 Å
SCOPe Domain Sequences for d4c2yb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4c2yb2 d.108.1.0 (B:296-496) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ywhrslnprklievkfshlsrnmtmqrtmklyrlpetpktaglrpmetkdipvvhqlltr
ylkqfhltpvmsqeevehwfypqeniidtfvvenangevtdflsfytlpstimnhpthks
lkaaysfynvhtqtplldlmsdalvlakmkgfdvfnaldlmenktfleklkfgigdgnlq
yylynwkcpsmgaekvglvlq
Timeline for d4c2yb2: