Lineage for d4u8hc1 (4u8h C:21-223)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1842687Fold c.28: Cryptochrome/photolyase, N-terminal domain [52424] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like
  4. 1842688Superfamily c.28.1: Cryptochrome/photolyase, N-terminal domain [52425] (2 families) (S)
    automatically mapped to Pfam PF00875
  5. 1842723Family c.28.1.0: automated matches [227292] (1 protein)
    not a true family
  6. 1842724Protein automated matches [227113] (2 species)
    not a true protein
  7. 1842732Species Mouse (Mus musculus) [TaxId:10090] [226619] (5 PDB entries)
  8. 1842742Domain d4u8hc1: 4u8h C:21-223 [260076]
    Other proteins in same PDB: d4u8ha2, d4u8hc2
    automated match to d4mlpa1
    complexed with zn

Details for d4u8hc1

PDB Entry: 4u8h (more details), 2.8 Å

PDB Description: crystal structure of mammalian period-cryptochrome complex
PDB Compounds: (C:) Cryptochrome-2

SCOPe Domain Sequences for d4u8hc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4u8hc1 c.28.1.0 (C:21-223) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
assvhwfrkglrlhdnpallaavrgarcvrcvyildpwfaasssvginrwrfllqsledl
dtslrklnsrlfvvrgqpadvfprlfkewgvtrltfeydsepfgkerdaaimkmakeagv
evvtenshtlydldriielngqkppltykrfqalisrmelpkkpavavssqqmescraei
qenhddtygvpsleelgfptegl

SCOPe Domain Coordinates for d4u8hc1:

Click to download the PDB-style file with coordinates for d4u8hc1.
(The format of our PDB-style files is described here.)

Timeline for d4u8hc1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4u8hc2