SCOPe 2.05: Domain d4mlpa1: 4mlp A:21-223

Lineage for d4mlpa1 (4mlp A:21-223)

Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
Fold c.28: Cryptochrome/photolyase, N-terminal domain [52424] (1 superfamily)
3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like
Superfamily c.28.1: Cryptochrome/photolyase, N-terminal domain [52425] (2 families)
automatically mapped to Pfam PF00875
Family c.28.1.0: automated matches [227292] (1 protein)
not a true family
Protein automated matches [227113] (2 species)
not a true protein
Species Mouse (Mus musculus) [TaxId:10090] [226619] (5 PDB entries)
Domain d4mlpa1: 4mlp A:21-223 [228407]
Other proteins in same PDB: d4mlpa2, d4mlpb2, d4mlpc2, d4mlpd2
automated match to d4k0ra1
complexed with 2cx

Details for d4mlpa1

PDB Entry: 4mlp (more details), 1.94 Å

PDB Description: Mammalian cryptochrome in complex with a small molecule competitor of its ubiquitin ligase

PDB Compounds: (A:) Cryptochrome-2

SCOPe Domain Sequences for d4mlpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mlpa1 c.28.1.0 (A:21-223) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
assvhwfrkglrlhdnpallaavrgarcvrcvyildpwfaasssvginrwrfllqsledl
dtslrklnsrlfvvrgqpadvfprlfkewgvtrltfeydsepfgkerdaaimkmakeagv
evvtenshtlydldriielngqkppltykrfqalisrmelpkkpavavssqqmescraei
qenhddtygvpsleelgfptegl

SCOPe Domain Coordinates for d4mlpa1:

Click to download the PDB-style file with coordinates for d4mlpa1.
(The format of our PDB-style files is described here.)

Timeline for d4mlpa1: