Lineage for d4mlpd2 (4mlp D:224-512)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1742357Fold a.99: Cryptochrome/photolyase FAD-binding domain [48172] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
  4. 1742358Superfamily a.99.1: Cryptochrome/photolyase FAD-binding domain [48173] (2 families) (S)
    automatically mapped to Pfam PF03441
  5. 1742359Family a.99.1.1: Cryptochrome/photolyase FAD-binding domain [48174] (3 proteins)
  6. 1742390Protein automated matches [228408] (1 species)
    not a true protein
  7. 1742391Species Mouse (Mus musculus) [TaxId:10090] [228409] (5 PDB entries)
  8. 1742395Domain d4mlpd2: 4mlp D:224-512 [228410]
    Other proteins in same PDB: d4mlpa1, d4mlpb1, d4mlpc1, d4mlpd1
    automated match to d4k0ra2
    complexed with 2cx

Details for d4mlpd2

PDB Entry: 4mlp (more details), 1.94 Å

PDB Description: Mammalian cryptochrome in complex with a small molecule competitor of its ubiquitin ligase
PDB Compounds: (D:) Cryptochrome-2

SCOPe Domain Sequences for d4mlpd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mlpd2 a.99.1.1 (D:224-512) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gpavwqggetealarldkhlerkawvanyerprmnansllasptglspylrfgclscrlf
yyrlwdlykkvkrnstpplslfgqllwreffytaatnnprfdrmegnpiciqipwdrnpe
alakwaegktgfpwidaimtqlrqegwihhlarhavacfltrgdlwvswesgvrvfdell
ldadfsvnagswmwlscsaffqqffhcycpvgfgrrtdpsgdyirrylpklkgfpsryiy
epwnapesvqkaakciigvdyprpivnhaetsrlniermkqiyqqlsry

SCOPe Domain Coordinates for d4mlpd2:

Click to download the PDB-style file with coordinates for d4mlpd2.
(The format of our PDB-style files is described here.)

Timeline for d4mlpd2: