![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.99: Cryptochrome/photolyase FAD-binding domain [48172] (1 superfamily) multihelical; consists of two all-alpha subdomains |
![]() | Superfamily a.99.1: Cryptochrome/photolyase FAD-binding domain [48173] (2 families) ![]() automatically mapped to Pfam PF03441 |
![]() | Family a.99.1.1: Cryptochrome/photolyase FAD-binding domain [48174] (3 proteins) |
![]() | Protein automated matches [228408] (1 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [228409] (17 PDB entries) |
![]() | Domain d4u8ha2: 4u8h A:224-510 [260075] Other proteins in same PDB: d4u8ha1, d4u8hc1 automated match to d4i6ga2 complexed with zn |
PDB Entry: 4u8h (more details), 2.8 Å
SCOPe Domain Sequences for d4u8ha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4u8ha2 a.99.1.1 (A:224-510) automated matches {Mouse (Mus musculus) [TaxId: 10090]} gpavwqggetealarldkhlerkawvanyerprmnansllasptglspylrfgclscrlf yyrlwdlykkvkrnstpplslfgqllwreffytaatnnprfdrmegnpiciqipwdrnpe alakwaegktgfpwidaimtqlrqegwihhlarhavacfltrgdlwvswesgvrvfdell ldadfsvnagswmwlscsaffqqffhcycpvgfgrrtdpsgdyirrylpklkgfpsryiy epwnapesvqkaakciigvdyprpivnhaetsrlniermkqiyqqls
Timeline for d4u8ha2: