SCOPe 2.05: Domain d4u7jb2: 4u7j B:173-398

Lineage for d4u7jb2 (4u7j B:173-398)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.210: Argininosuccinate synthetase, C-terminal domain [69863] (1 superfamily)
   unusual fold

4. Superfamily d.210.1: Argininosuccinate synthetase, C-terminal domain [69864] (2 families)

5. Family d.210.1.0: automated matches [227194] (1 protein)
   not a true family

6. Protein automated matches [226921] (3 species)
   not a true protein

7. Species Mycobacterium thermoresistibile [TaxId:1078020] [260071] (2 PDB entries)

8. Domain d4u7jb2: 4u7j B:173-398 [260072]
   Other proteins in same PDB: d4u7ja1, d4u7jb1
   automated match to d1j20a2
   complexed with cl, edo

Details for d4u7jb2

PDB Entry: 4u7j, 1.75 Å

PDB Description: crystal structure of argininosuccinate synthase from mycobacterium thermoresistibile

PDB Compounds: (B:) argininosuccinate synthase

SCOPe Domain Sequences for d4u7jb2:

Sequence; same for both SEQRES and ATOM records:

>d4u7jb2 d.210.1.0 (B:173-398) automated matches {Mycobacterium thermoresistibile [TaxId: 1078020]}
pfsidqnvwgravetgflehlwnaptkdvysytedptvnwstpdevivgfeqgvpvsidg
rsvtplqaieelnrrggeqgvgrldvvedrlvgiksreiyeapgamvlitahtelehvtl
erelgrfkritdqkwgelvydglwfsplktalesfvaktqehvtgeirmvlhgghiavng
rrspkslydfnlatydegdtfdqsaakgfvqihglsssisarrdlq

Timeline for d4u7jb2:

• d4u7jb2 first appeared in SCOPe 2.04
  
• d4u7jb2 appears in SCOPe 2.06
  
• d4u7jb2 appears in the current release, SCOPe 2.08