| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.210: Argininosuccinate synthetase, C-terminal domain [69863] (1 superfamily) unusual fold |
Superfamily d.210.1: Argininosuccinate synthetase, C-terminal domain [69864] (2 families) ![]() |
| Family d.210.1.0: automated matches [227194] (1 protein) not a true family |
| Protein automated matches [226921] (3 species) not a true protein |
| Species Mycobacterium thermoresistibile [TaxId:1078020] [260071] (2 PDB entries) |
| Domain d4u7jb2: 4u7j B:173-398 [260072] Other proteins in same PDB: d4u7ja1, d4u7jb1 automated match to d1j20a2 complexed with cl, edo |
PDB Entry: 4u7j (more details), 1.75 Å
SCOPe Domain Sequences for d4u7jb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4u7jb2 d.210.1.0 (B:173-398) automated matches {Mycobacterium thermoresistibile [TaxId: 1078020]}
pfsidqnvwgravetgflehlwnaptkdvysytedptvnwstpdevivgfeqgvpvsidg
rsvtplqaieelnrrggeqgvgrldvvedrlvgiksreiyeapgamvlitahtelehvtl
erelgrfkritdqkwgelvydglwfsplktalesfvaktqehvtgeirmvlhgghiavng
rrspkslydfnlatydegdtfdqsaakgfvqihglsssisarrdlq
Timeline for d4u7jb2: