SCOPe 2.05: Domain d4u7jb1: 4u7j B:3-172

Lineage for d4u7jb1 (4u7j B:3-172)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families)
   share similar mode of ligand (Adenosine group) binding
   can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

5. Family c.26.2.0: automated matches [191320] (1 protein)
   not a true family

6. Protein automated matches [190116] (18 species)
   not a true protein

7. Species Mycobacterium thermoresistibile [TaxId:1078020] [260068] (2 PDB entries)

8. Domain d4u7jb1: 4u7j B:3-172 [260069]
   Other proteins in same PDB: d4u7ja2, d4u7jb2
   automated match to d1j20a1
   complexed with cl, edo

Details for d4u7jb1

PDB Entry: 4u7j, 1.75 Å

PDB Description: crystal structure of argininosuccinate synthase from mycobacterium thermoresistibile

PDB Compounds: (B:) argininosuccinate synthase

SCOPe Domain Sequences for d4u7jb1:

Sequence, based on SEQRES records:

>d4u7jb1 c.26.2.0 (B:3-172) automated matches {Mycobacterium thermoresistibile [TaxId: 1078020]}
ervilaysggldtsvaiswigketgrevvavaidlgqggedmevvrqraldcgavesivi
dardefandycvpaiqsnalymdryplvsalsrplivkhlvkaarehggtivahgctgkg
ndqvrfevgfaslapdlevlapvrdyawtrekaiafaeennipinvtkrs

Sequence, based on observed residues (ATOM records):

>d4u7jb1 c.26.2.0 (B:3-172) automated matches {Mycobacterium thermoresistibile [TaxId: 1078020]}
ervilaysggldtsvaiswigketgrevvavaidlgqggedmevvrqraldcgavesivi
dardefandycvpaiqsnalymdryplvsalsrplivkhlvkaarehggtivahgctgkg
ndqvrfevgfaslapdlevlapvrdyawtrekaiafanvtkrs

Timeline for d4u7jb1:

• d4u7jb1 first appeared in SCOPe 2.04
  
• d4u7jb1 appears in SCOPe 2.06
  
• d4u7jb1 appears in the current release, SCOPe 2.08