Lineage for d4u7ja1 (4u7j A:3-172)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2118897Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2119957Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 2120231Family c.26.2.0: automated matches [191320] (1 protein)
    not a true family
  6. 2120232Protein automated matches [190116] (24 species)
    not a true protein
  7. 2120296Species Mycobacterium thermoresistibile [TaxId:1078020] [260068] (2 PDB entries)
  8. 2120299Domain d4u7ja1: 4u7j A:3-172 [260070]
    Other proteins in same PDB: d4u7ja2, d4u7jb2
    automated match to d1j20a1
    complexed with cl, edo

Details for d4u7ja1

PDB Entry: 4u7j (more details), 1.75 Å

PDB Description: crystal structure of argininosuccinate synthase from mycobacterium thermoresistibile
PDB Compounds: (A:) argininosuccinate synthase

SCOPe Domain Sequences for d4u7ja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4u7ja1 c.26.2.0 (A:3-172) automated matches {Mycobacterium thermoresistibile [TaxId: 1078020]}
ervilaysggldtsvaiswigketgrevvavaidlgqggedmevvrqraldcgavesivi
dardefandycvpaiqsnalymdryplvsalsrplivkhlvkaarehggtivahgctgkg
ndqvrfevgfaslapdlevlapvrdyawtrekaiafaeennipinvtkrs

SCOPe Domain Coordinates for d4u7ja1:

Click to download the PDB-style file with coordinates for d4u7ja1.
(The format of our PDB-style files is described here.)

Timeline for d4u7ja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4u7ja2