Lineage for d4tqoj_ (4tqo J:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1505912Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 1505975Superfamily a.137.2: Methanol dehydrogenase subunit [48666] (1 family) (S)
    consists of single alpha-helix and irregular N-terminal tail
    automatically mapped to Pfam PF02315
  5. 1505976Family a.137.2.1: Methanol dehydrogenase subunit [48667] (2 proteins)
  6. 1506001Protein automated matches [190583] (2 species)
    not a true protein
  7. 1506006Species Methylococcus capsulatus [TaxId:243233] [260039] (1 PDB entry)
  8. 1506008Domain d4tqoj_: 4tqo J: [260040]
    Other proteins in same PDB: d4tqoa_
    automated match to d1w6sb_
    complexed with ca, pqq

Details for d4tqoj_

PDB Entry: 4tqo (more details), 2.57 Å

PDB Description: the crystal structure of methanol dehydrogenase from methylococcus capsulatus (bath)
PDB Compounds: (J:) Methanol dehydrogenase, small subunit

SCOPe Domain Sequences for d4tqoj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4tqoj_ a.137.2.1 (J:) automated matches {Methylococcus capsulatus [TaxId: 243233]}
ydgthckapgncwepkpgypdkvagskydpkhdpnelnkqaesikamearnqkrvenyak
tgkfvykvedi

SCOPe Domain Coordinates for d4tqoj_:

Click to download the PDB-style file with coordinates for d4tqoj_.
(The format of our PDB-style files is described here.)

Timeline for d4tqoj_: