Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.86: eIF4e-like [55417] (1 superfamily) beta(2)-alpha-beta(2)-alpha-beta(2)-alpha-beta-2; 2 layers: alpha/beta; antiparallel sheet: 21356478 |
Superfamily d.86.1: eIF4e-like [55418] (3 families) |
Family d.86.1.1: Translation initiation factor eIF4e [55419] (1 protein) automatically mapped to Pfam PF01652 |
Protein Translation initiation factor eIF4e [55420] (3 species) messenger RNA 5' cap-binding protein |
Species Human (Homo sapiens) [TaxId:9606] [160542] (16 PDB entries) |
Domain d4tpwb_: 4tpw B: [260036] automated match to d1ipca_ complexed with 33r, mes, mgp |
PDB Entry: 4tpw (more details), 1.5 Å
SCOPe Domain Sequences for d4tpwb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4tpwb_ d.86.1.1 (B:) Translation initiation factor eIF4e {Human (Homo sapiens) [TaxId: 9606]} ikhplqnrwalwffkndksktwqanlrliskfdtvedfwalynhiqlssnlmpgcdyslf kdgiepmwedeknkrggrwlitlnkqqrrsdldrfwletllcligesfddysddvcgavv nvrakgdkiaiwttecenreavthigrvykerlglppkivigyqshadtatksgsttknr fvv
Timeline for d4tpwb_: