SCOPe 2.08: Domain d4tpwa_: 4tpw A:

Lineage for d4tpwa_ (4tpw A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.86: eIF4e-like [55417] (1 superfamily)
   beta(2)-alpha-beta(2)-alpha-beta(2)-alpha-beta-2; 2 layers: alpha/beta; antiparallel sheet: 21356478

4. Superfamily d.86.1: eIF4e-like [55418] (3 families)

5. Family d.86.1.1: Translation initiation factor eIF4e [55419] (1 protein)
   automatically mapped to Pfam PF01652

6. Protein Translation initiation factor eIF4e [55420] (3 species)
   messenger RNA 5' cap-binding protein

7. Species Human (Homo sapiens) [TaxId:9606] [160542] (16 PDB entries)

8. Domain d4tpwa_: 4tpw A: [259026]
   automated match to d1ipca_
   complexed with 33r, mes, mgp

Details for d4tpwa_

PDB Entry: 4tpw, 1.5 Å

PDB Description: the co-complex structure of the translation initiation factor eif4e with the inhibitor 4egi-1 reveals an allosteric mechanism for dissociating eif4g

PDB Compounds: (A:) eukaryotic translation initiation factor 4e

SCOPe Domain Sequences for d4tpwa_:

Sequence; same for both SEQRES and ATOM records:

>d4tpwa_ d.86.1.1 (A:) Translation initiation factor eIF4e {Human (Homo sapiens) [TaxId: 9606]}
hyikhplqnrwalwffkndksktwqanlrliskfdtvedfwalynhiqlssnlmpgcdys
lfkdgiepmwedeknkrggrwlitlnkqqrrsdldrfwletllcligesfddysddvcga
vvnvrakgdkiaiwttecenreavthigrvykerlglppkivigyqshadtatksgsttk
nrfvv

Timeline for d4tpwa_:

• d4tpwa_ first appeared in SCOPe 2.04
  
• d4tpwa_ appears in SCOPe 2.07