Class b: All beta proteins [48724] (176 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins) |
Protein Trypsin(ogen) [50515] (9 species) |
Species Atlantic salmon (Salmo salar) [TaxId:8030] [50520] (11 PDB entries) |
Domain d1a0jb_: 1a0j B: [26003] complexed with ben, ca, so4 |
PDB Entry: 1a0j (more details), 1.7 Å
SCOPe Domain Sequences for d1a0jb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a0jb_ b.47.1.2 (B:) Trypsin(ogen) {Atlantic salmon (Salmo salar) [TaxId: 8030]} ivggyecrknsasyqaslqsgyhfcggslisstwvvsaahcyksriqvrlgehniavneg teqfidsvkvimhpsynsrnldndimliklskpaslnsyvstvalpsscassgtrclvsg wgnlsgsssnypdtlrcldlpilsssscnsaypgqitsnmfcagfmeggkdscqgdsggp vvcngqlqgvvswgygcaqrnkpgvytkvcnyrswisstmssn
Timeline for d1a0jb_: