Lineage for d4osoa_ (4oso A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2454167Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2454168Protein automated matches [190069] (309 species)
    not a true protein
  7. 2457030Species Streptomyces cyanogenus [TaxId:80860] [235237] (3 PDB entries)
  8. 2457035Domain d4osoa_: 4oso A: [259882]
    Other proteins in same PDB: d4osob2
    automated match to d4kwib_
    complexed with 2v4, nap, peg

Details for d4osoa_

PDB Entry: 4oso (more details), 2.5 Å

PDB Description: The crystal structure of landomycin C-6 ketoreductase LanV with bound NADP and rabelomycin
PDB Compounds: (A:) Reductase homolog

SCOPe Domain Sequences for d4osoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4osoa_ c.2.1.0 (A:) automated matches {Streptomyces cyanogenus [TaxId: 80860]}
gnltgktalvtgasrgigraiaeklgyagalvavhyatgadaaaevaesiekdggraftv
kaelgvpgdvdvlfeglerglkertgatdldilvnnagvmamgapeevtpemfdrmmavn
akapffivqralsvmpdggriinvssgltrvaspdqvtygmskgaleqialhfsrhlgsr
ritvnsvapgstdngsalfqipevretlsqlstfgevaepaaiadvvaflasedarwitg
afidasggtllg

SCOPe Domain Coordinates for d4osoa_:

Click to download the PDB-style file with coordinates for d4osoa_.
(The format of our PDB-style files is described here.)

Timeline for d4osoa_: