Lineage for d4nx2a1 (4nx2 A:1-306)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2468308Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2468309Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2468310Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 2468547Protein automated matches [190581] (10 species)
    not a true protein
  7. 2468565Species Methanocaldococcus jannaschii [TaxId:2190] [188187] (8 PDB entries)
  8. 2468569Domain d4nx2a1: 4nx2 A:1-306 [259842]
    Other proteins in same PDB: d4nx2a2
    automated match to d4hpwa_
    complexed with 2lt

Details for d4nx2a1

PDB Entry: 4nx2 (more details), 2 Å

PDB Description: crystal structure of dcyrs complexed with dcy
PDB Compounds: (A:) Tyrosine--tRNA ligase

SCOPe Domain Sequences for d4nx2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nx2a1 c.26.1.1 (A:1-306) automated matches {Methanocaldococcus jannaschii [TaxId: 2190]}
mdefemikrntseiiseeelrevlkkdeksaligfepsgkihlghylqikkmidlqnagf
diiiiladlgaylnqkgeldeirkigdynkkvfeamglkakyvygseilldkdgtlnvyr
lalkttlkrarrsmeliaredenpkvaeviypimqvnsihymgvdvavggmeqrkihmla
rellpkkvvcihnpvltgldgegkmssskgnfiavddspeeirakikkaycpagvvegnp
imeiakyfleypltikrpekfggdltvnsyeeleslfknkelhpmdlknavaeelikile
pirkrl

SCOPe Domain Coordinates for d4nx2a1:

Click to download the PDB-style file with coordinates for d4nx2a1.
(The format of our PDB-style files is described here.)

Timeline for d4nx2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4nx2a2