Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) |
Family d.14.1.9: Imidazole glycerol phosphate dehydratase [102766] (2 proteins) duplication; there are two structural repeats of this fold |
Protein automated matches [254526] (2 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [255158] (11 PDB entries) |
Domain d4mu0a2: 4mu0 A:96-193 [259815] Other proteins in same PDB: d4mu0a1 automated match to d2f1da2 complexed with cl, edo, mn, tri, trs |
PDB Entry: 4mu0 (more details), 1.3 Å
SCOPe Domain Sequences for d4mu0a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mu0a2 d.14.1.9 (A:96-193) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} ginrfgdftapldealihvsldlsgrpylgynleiptqrvgtydtqlvehffqslvntsg mtlhirqlagknshhiieatfkafaralrqatesdprr
Timeline for d4mu0a2: