SCOPe 2.05: Domain d4k42c2: 4k42 C:147-374

Lineage for d4k42c2 (4k42 C:147-374)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)

6. Protein Actin [53073] (7 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53075] (62 PDB entries)
   Uniprot P02568 ! SQ 02568

8. Domain d4k42c2: 4k42 C:147-374 [259767]
   automated match to d1qz5a2
   complexed with adp, ca, nwm

Details for d4k42c2

PDB Entry: 4k42, 2.9 Å

PDB Description: crystal structure of actin in complex with synthetic aplc tail analogue sf01 [(3r,4s,5r,6s,10r,11r,12r)-11-(acetyloxy)-1-(benzyloxy)-14-[formyl(methyl)amino]-5-hydroxy-4,6,10,12-tetramethyl-9-oxotetradecan-3-yl propanoate]

PDB Compounds: (C:) Actin, alpha skeletal muscle

SCOPe Domain Sequences for d4k42c2:

Sequence; same for both SEQRES and ATOM records:

>d4k42c2 c.55.1.1 (C:147-374) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
rttgivldsgdgvthnvpiyegyalphaimrldlagrdltdylmkiltergysfvttaer
eivrdikeklcyvaldfenemataassssleksyelpdgqvitignerfrcpetlfqpsf
igmesagihettynsimkcdidirkdlyannvmsggttmypgiadrmqkeitalapstmk
ikiiapperkysvwiggsilaslstfqqmwitkqeydeagpsivhrkc

Timeline for d4k42c2:

• d4k42c2 first appeared in SCOPe 2.04
  
• d4k42c2 appears in SCOPe 2.06
  
• d4k42c2 appears in the current release, SCOPe 2.08