Lineage for d4k42c1 (4k42 C:5-146)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1857400Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1857401Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1857402Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 1857403Protein Actin [53073] (7 species)
  7. 1857429Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53075] (62 PDB entries)
    Uniprot P02568 ! SQ 02568
  8. 1857572Domain d4k42c1: 4k42 C:5-146 [259766]
    automated match to d1qz5a1
    complexed with adp, ca, nwm

Details for d4k42c1

PDB Entry: 4k42 (more details), 2.9 Å

PDB Description: crystal structure of actin in complex with synthetic aplc tail analogue sf01 [(3r,4s,5r,6s,10r,11r,12r)-11-(acetyloxy)-1-(benzyloxy)-14-[formyl(methyl)amino]-5-hydroxy-4,6,10,12-tetramethyl-9-oxotetradecan-3-yl propanoate]
PDB Compounds: (C:) Actin, alpha skeletal muscle

SCOPe Domain Sequences for d4k42c1:

Sequence, based on SEQRES records: (download)

>d4k42c1 c.55.1.1 (C:5-146) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ttalvcdngsglvkagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrgi
ltlkypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimf
etfnvpamyvaiqavlslyasg

Sequence, based on observed residues (ATOM records): (download)

>d4k42c1 c.55.1.1 (C:5-146) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ttalvcdngsglvkagfagddapravfpsivgrprqkdsyvgdeaqskrgiltlkypieh
giitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimfetfnvpamy
vaiqavlslyasg

SCOPe Domain Coordinates for d4k42c1:

Click to download the PDB-style file with coordinates for d4k42c1.
(The format of our PDB-style files is described here.)

Timeline for d4k42c1: