Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) |
Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins) |
Protein Zn metallo-beta-lactamase [56283] (14 species) |
Species Pseudomonas aeruginosa [TaxId:1089456] [259726] (1 PDB entry) |
Domain d4uamb_: 4uam B: [259730] automated match to d1jjta_ complexed with fe, flc, zn |
PDB Entry: 4uam (more details), 1.8 Å
SCOPe Domain Sequences for d4uamb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4uamb_ d.157.1.1 (B:) Zn metallo-beta-lactamase {Pseudomonas aeruginosa [TaxId: 1089456]} slpdlkiekldegvyvhtsfeevngwgvvpkhglvvlvnaeaylidtpftakdteklvtw fvergykikgsisshfhsdstggiewlnsrsiptyaseltnellkkdgkvqatnsfsgvn ywlvknkievfypgpghtpdnvvvwlperkilfggcfikpyglgnlgdanieawpksakl lkskygkaklvvpshsevgdasllkltleqavkglneskk
Timeline for d4uamb_: