Lineage for d4uamb_ (4uam B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2996664Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2996665Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) (S)
  5. 2996666Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 2996667Protein Zn metallo-beta-lactamase [56283] (14 species)
  7. 2996762Species Pseudomonas aeruginosa [TaxId:1089456] [259726] (1 PDB entry)
  8. 2996764Domain d4uamb_: 4uam B: [259730]
    automated match to d1jjta_
    complexed with fe, flc, zn

Details for d4uamb_

PDB Entry: 4uam (more details), 1.8 Å

PDB Description: 1.8 angstrom crystal structure of imp-1 metallo-beta-lactamase with a mixed iron-zinc center in the active site
PDB Compounds: (B:) IMP-1 metallo-beta-lactamase

SCOPe Domain Sequences for d4uamb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uamb_ d.157.1.1 (B:) Zn metallo-beta-lactamase {Pseudomonas aeruginosa [TaxId: 1089456]}
slpdlkiekldegvyvhtsfeevngwgvvpkhglvvlvnaeaylidtpftakdteklvtw
fvergykikgsisshfhsdstggiewlnsrsiptyaseltnellkkdgkvqatnsfsgvn
ywlvknkievfypgpghtpdnvvvwlperkilfggcfikpyglgnlgdanieawpksakl
lkskygkaklvvpshsevgdasllkltleqavkglneskk

SCOPe Domain Coordinates for d4uamb_:

Click to download the PDB-style file with coordinates for d4uamb_.
(The format of our PDB-style files is described here.)

Timeline for d4uamb_: