Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.151: DNase I-like [56218] (1 superfamily) contains beta-sandwich; duplication of alpha+beta motif |
Superfamily d.151.1: DNase I-like [56219] (4 families) |
Family d.151.1.2: Inositol polyphosphate 5-phosphatase (IPP5) [64422] (3 proteins) |
Protein automated matches [190040] (1 species) not a true protein |
Species Bedbug (Cimex lectularius) [TaxId:79782] [186761] (7 PDB entries) |
Domain d4l1za_: 4l1z A: [259657] automated match to d1y21a_ complexed with hem; mutant |
PDB Entry: 4l1z (more details), 1.65 Å
SCOPe Domain Sequences for d4l1za_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4l1za_ d.151.1.2 (A:) automated matches {Bedbug (Cimex lectularius) [TaxId: 79782]} ppaqlsvhtvswnsgheraptnleellglnsgetpdviavavqgfgfqtdkpqqgpacvk nvqslltskgytklkntitetmgltvyclekhldqntlknetiivtvddqkksggivtsf tiynkrfsfttsrmsdedvtstntkyaydtrldyskkddpsdflfwigdlnvrvetnath akslvdqnnidglmafdqlkkakeqklfdgwtepqvtfkptykfkpntdeydlsatpswt dralyksgtgktiqplsynsltnykqtehrpvlakfrvtl
Timeline for d4l1za_: