Lineage for d4l1za_ (4l1z A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594378Fold d.151: DNase I-like [56218] (1 superfamily)
    contains beta-sandwich; duplication of alpha+beta motif
  4. 2594379Superfamily d.151.1: DNase I-like [56219] (4 families) (S)
  5. 2594457Family d.151.1.2: Inositol polyphosphate 5-phosphatase (IPP5) [64422] (3 proteins)
  6. 2594467Protein automated matches [190040] (1 species)
    not a true protein
  7. 2594468Species Bedbug (Cimex lectularius) [TaxId:79782] [186761] (7 PDB entries)
  8. 2594475Domain d4l1za_: 4l1z A: [259657]
    automated match to d1y21a_
    complexed with hem; mutant

Details for d4l1za_

PDB Entry: 4l1z (more details), 1.65 Å

PDB Description: crystal structure of cimex nitrophorin f64v mutant
PDB Compounds: (A:) Salivary nitrophorin

SCOPe Domain Sequences for d4l1za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4l1za_ d.151.1.2 (A:) automated matches {Bedbug (Cimex lectularius) [TaxId: 79782]}
ppaqlsvhtvswnsgheraptnleellglnsgetpdviavavqgfgfqtdkpqqgpacvk
nvqslltskgytklkntitetmgltvyclekhldqntlknetiivtvddqkksggivtsf
tiynkrfsfttsrmsdedvtstntkyaydtrldyskkddpsdflfwigdlnvrvetnath
akslvdqnnidglmafdqlkkakeqklfdgwtepqvtfkptykfkpntdeydlsatpswt
dralyksgtgktiqplsynsltnykqtehrpvlakfrvtl

SCOPe Domain Coordinates for d4l1za_:

Click to download the PDB-style file with coordinates for d4l1za_.
(The format of our PDB-style files is described here.)

Timeline for d4l1za_: