Lineage for d4cava2 (4cav A:263-492)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1664276Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1664277Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 1664807Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 1664808Protein automated matches [190038] (28 species)
    not a true protein
  7. 1664824Species Aspergillus fumigatus [TaxId:746128] [259642] (5 PDB entries)
  8. 1664830Domain d4cava2: 4cav A:263-492 [259646]
    automated match to d1iica2
    complexed with 2xq, cl, mya

Details for d4cava2

PDB Entry: 4cav (more details), 1.89 Å

PDB Description: crystal structure of aspergillus fumigatus n-myristoyl transferase in complex with myristoyl coa and a benzofuran ligand r0-09-4879
PDB Compounds: (A:) Glycylpeptide N-tetradecanoyltransferase

SCOPe Domain Sequences for d4cava2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cava2 d.108.1.0 (A:263-492) automated matches {Aspergillus fumigatus [TaxId: 746128]}
yyhrpldwlklyevgfsplpagstkarqitknhlpsttstpglrpmepkdidtvhdllqr
ylsrfalnqaftreevdhwlvhkpetvkeqvvwayvvedpethkitdffsfynlestviq
npkhdnvraaylyyyatetaftnnmkalkerllmlmndalilakkahfdvfnaltlhdnp
lfleqlkfgagdgqlhfylynyrtapvpggvneknlpdekrmggvgivml

SCOPe Domain Coordinates for d4cava2:

Click to download the PDB-style file with coordinates for d4cava2.
(The format of our PDB-style files is described here.)

Timeline for d4cava2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4cava1