![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
![]() | Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
![]() | Protein Trypsin(ogen) [50515] (9 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [50516] (500 PDB entries) Uniprot P00760 |
![]() | Domain d1c9td_: 1c9t D: [25958] Other proteins in same PDB: d1c9tg_, d1c9th_, d1c9ti_, d1c9tj_, d1c9tk_, d1c9tl_ |
PDB Entry: 1c9t (more details), 3.3 Å
SCOPe Domain Sequences for d1c9td_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c9td_ b.47.1.2 (D:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
Timeline for d1c9td_: