Lineage for d4w9cl_ (4w9c L:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1772695Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 1772863Superfamily b.3.3: VHL [49468] (1 family) (S)
    automatically mapped to Pfam PF01847
  5. 1772864Family b.3.3.1: VHL [49469] (2 proteins)
  6. 1772865Protein VHL [49470] (1 species)
  7. 1772866Species Human (Homo sapiens) [TaxId:9606] [49471] (17 PDB entries)
  8. 1772896Domain d4w9cl_: 4w9c L: [259574]
    Other proteins in same PDB: d4w9ca_, d4w9cb_, d4w9cd_, d4w9ce_, d4w9cg_, d4w9ch_, d4w9cj_, d4w9ck_
    automated match to d1lqbc_
    complexed with 3jg

Details for d4w9cl_

PDB Entry: 4w9c (more details), 2.2 Å

PDB Description: pVHL:EloB:EloC in complex with (2S,4R)-1-(3,3-dimethylbutanoyl)-4-hydroxy-N-(4-(oxazol-5-yl)benzyl)pyrrolidine-2-carboxamide (ligand 2)
PDB Compounds: (L:) von hippel-lindau disease tumor suppressor

SCOPe Domain Sequences for d4w9cl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4w9cl_ b.3.3.1 (L:) VHL {Human (Homo sapiens) [TaxId: 9606]}
vlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrd
agthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldiv
rslyedledhpnvqkdlerltqe

SCOPe Domain Coordinates for d4w9cl_:

Click to download the PDB-style file with coordinates for d4w9cl_.
(The format of our PDB-style files is described here.)

Timeline for d4w9cl_: