Lineage for d4w9cb_ (4w9c B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1903244Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 1903245Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 1903246Family d.42.1.1: BTB/POZ domain [54696] (6 proteins)
  6. 1903304Protein Elongin C [54699] (3 species)
  7. 1903307Species Human (Homo sapiens) [TaxId:9606] [54700] (30 PDB entries)
  8. 1903342Domain d4w9cb_: 4w9c B: [264021]
    Other proteins in same PDB: d4w9ca_, d4w9cc_, d4w9cd_, d4w9cf_, d4w9cg_, d4w9ci_, d4w9cj_, d4w9cl_
    automated match to d4b9kb_
    complexed with 3jg

Details for d4w9cb_

PDB Entry: 4w9c (more details), 2.2 Å

PDB Description: pVHL:EloB:EloC in complex with (2S,4R)-1-(3,3-dimethylbutanoyl)-4-hydroxy-N-(4-(oxazol-5-yl)benzyl)pyrrolidine-2-carboxamide (ligand 2)
PDB Compounds: (B:) Transcription elongation factor B polypeptide 1

SCOPe Domain Sequences for d4w9cb_:

Sequence, based on SEQRES records: (download)

>d4w9cb_ d.42.1.1 (B:) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy
ftykvrytnssteipefpiapeialellmaanfldc

Sequence, based on observed residues (ATOM records): (download)

>d4w9cb_ d.42.1.1 (B:) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlsnevnfreipshvlskvcmyftykvrytns
steipefpiapeialellmaanfldc

SCOPe Domain Coordinates for d4w9cb_:

Click to download the PDB-style file with coordinates for d4w9cb_.
(The format of our PDB-style files is described here.)

Timeline for d4w9cb_: