Lineage for d4r5ka1 (4r5k A:381-503)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1814264Fold b.130: Heat shock protein 70kD (HSP70), peptide-binding domain [100919] (1 superfamily)
    beta-sandwich: 8 strands in 2 sheets
  4. 1814265Superfamily b.130.1: Heat shock protein 70kD (HSP70), peptide-binding domain [100920] (1 family) (S)
  5. 1814266Family b.130.1.1: Heat shock protein 70kD (HSP70), peptide-binding domain [100921] (3 proteins)
  6. 1814286Protein automated matches [227117] (2 species)
    not a true protein
  7. 1814291Species Escherichia coli [TaxId:83333] [259516] (3 PDB entries)
  8. 1814292Domain d4r5ka1: 4r5k A:381-503 [259520]
    Other proteins in same PDB: d4r5ka2, d4r5kb2
    automated match to d1dkxa2
    complexed with ca, so4

Details for d4r5ka1

PDB Entry: 4r5k (more details), 1.75 Å

PDB Description: Crystal structure of the DnaK C-terminus (Dnak-SBD-B)
PDB Compounds: (A:) Chaperone protein dnaK

SCOPe Domain Sequences for d4r5ka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4r5ka1 b.130.1.1 (A:381-503) automated matches {Escherichia coli [TaxId: 83333]}
hhhhhhievllldvtplslgietmggvmttliaknttiptkhsqvfstaednqsavtihv
lqgerkraadnkslgqfnldginpaprgmpqievtfdidadgilhvsakdknsgkeqkit
ika

SCOPe Domain Coordinates for d4r5ka1:

Click to download the PDB-style file with coordinates for d4r5ka1.
(The format of our PDB-style files is described here.)

Timeline for d4r5ka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4r5ka2