Class b: All beta proteins [48724] (176 folds) |
Fold b.130: Heat shock protein 70kD (HSP70), peptide-binding domain [100919] (1 superfamily) beta-sandwich: 8 strands in 2 sheets |
Superfamily b.130.1: Heat shock protein 70kD (HSP70), peptide-binding domain [100920] (1 family) |
Family b.130.1.1: Heat shock protein 70kD (HSP70), peptide-binding domain [100921] (3 proteins) |
Protein automated matches [227117] (2 species) not a true protein |
Species Escherichia coli [TaxId:83333] [259516] (3 PDB entries) |
Domain d4r5ka1: 4r5k A:381-503 [259520] Other proteins in same PDB: d4r5ka2, d4r5kb2 automated match to d1dkxa2 complexed with ca, so4 |
PDB Entry: 4r5k (more details), 1.75 Å
SCOPe Domain Sequences for d4r5ka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4r5ka1 b.130.1.1 (A:381-503) automated matches {Escherichia coli [TaxId: 83333]} hhhhhhievllldvtplslgietmggvmttliaknttiptkhsqvfstaednqsavtihv lqgerkraadnkslgqfnldginpaprgmpqievtfdidadgilhvsakdknsgkeqkit ika
Timeline for d4r5ka1: