![]() | Class a: All alpha proteins [46456] (286 folds) |
![]() | Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold |
![]() | Superfamily a.8.4: Heat shock protein 70kD (HSP70), C-terminal subdomain [100934] (2 families) ![]() |
![]() | Family a.8.4.1: Heat shock protein 70kD (HSP70), C-terminal subdomain [100935] (3 proteins) |
![]() | Protein automated matches [227118] (3 species) not a true protein |
![]() | Species Escherichia coli [TaxId:83333] [259518] (3 PDB entries) |
![]() | Domain d4r5ka2: 4r5k A:508-605 [259521] Other proteins in same PDB: d4r5ka1, d4r5kb1 automated match to d1dkxa1 complexed with ca, so4 |
PDB Entry: 4r5k (more details), 1.75 Å
SCOPe Domain Sequences for d4r5ka2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4r5ka2 a.8.4.1 (A:508-605) automated matches {Escherichia coli [TaxId: 83333]} nedeiqkmvrdaeanaeadrkfeelvqtrnqgdhllhstrkqveeagdklpaddktaies altaletalkgedkaaieakmqelaqvsqklmeiaqqq
Timeline for d4r5ka2: