Lineage for d4ntnd_ (4ntn D:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1919500Fold d.96: T-fold [55619] (2 superfamilies)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
    tunnel-shaped: its known members form wide oligomeric barrels different sizes
  4. 1919501Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) (S)
    bind purine or pterin in topologically similar sites between subunits
  5. 1920048Family d.96.1.0: automated matches [227243] (1 protein)
    not a true family
  6. 1920049Protein automated matches [227009] (9 species)
    not a true protein
  7. 1920081Species Escherichia coli [TaxId:469008] [230194] (6 PDB entries)
  8. 1920090Domain d4ntnd_: 4ntn D: [259410]
    automated match to d3qn9a_
    complexed with fmt, zn

Details for d4ntnd_

PDB Entry: 4ntn (more details), 1.99 Å

PDB Description: e.coli qued, semet protein, 2a resolution
PDB Compounds: (D:) 6-carboxy-5,6,7,8-tetrahydropterin synthase

SCOPe Domain Sequences for d4ntnd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ntnd_ d.96.1.0 (D:) automated matches {Escherichia coli [TaxId: 469008]}
sttlfkdftfeaahrlphvpeghkcgrlhghsfmvrleitgevdphtgwiidfaelkaaf
kptyerldhhylndipglenptsevlakwiwdqvkpvvpllsavmvketctagciyrge

SCOPe Domain Coordinates for d4ntnd_:

Click to download the PDB-style file with coordinates for d4ntnd_.
(The format of our PDB-style files is described here.)

Timeline for d4ntnd_: