| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (31 families) ![]() has a beta-alpha(2)-beta insertion after the main helix |
| Family d.17.4.0: automated matches [191337] (1 protein) not a true family |
| Protein automated matches [190205] (19 species) not a true protein |
| Species Staphylococcus aureus [TaxId:158878] [256155] (3 PDB entries) |
| Domain d4cpkb1: 4cpk B:27-138 [259337] Other proteins in same PDB: d4cpkb2, d4cpkb3 automated match to d1vqqa1 complexed with cd, cl, mur; mutant |
PDB Entry: 4cpk (more details), 2.35 Å
SCOPe Domain Sequences for d4cpkb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cpkb1 d.17.4.0 (B:27-138) automated matches {Staphylococcus aureus [TaxId: 158878]}
dkeinntidaiedknfkqvykdssyisksdngevemterpikiynslgvkdiniqdrkik
kvsknkkrvdaqykiktnygnidrnvqfnfvkedgmwkldwdhsviipgmqk
Timeline for d4cpkb1: