Lineage for d4cf6b_ (4cf6 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2856357Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2856520Family c.23.5.3: Quinone reductase [52235] (4 proteins)
    binds FAD
  6. 2856755Protein automated matches [190235] (2 species)
    not a true protein
  7. 2856756Species Human (Homo sapiens) [TaxId:9606] [187003] (4 PDB entries)
  8. 2856766Domain d4cf6b_: 4cf6 B: [259331]
    automated match to d1d4aa_
    complexed with cbd, fad

Details for d4cf6b_

PDB Entry: 4cf6 (more details), 2.69 Å

PDB Description: crystal structure of the complex of the p187s variant of human nad(p) h:quinone oxidoreductase with cibacron blue at 2.7 a resolution
PDB Compounds: (B:) nad(p)h dehydrogenase [quinone] 1

SCOPe Domain Sequences for d4cf6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cf6b_ c.23.5.3 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rralivlahsertsfnyamkeaaaaalkkkgwevvesdlyamnfnpiisrkditgklkdp
anfqypaesvlaykeghlspdivaeqkkleaadlvifqfplqwfgvpailkgwfervfig
efaytyaamydkgpfrskkavlsittggsgsmyslqgihgdmnvilwpiqsgilhfcgfq
vlesqltysightpadariqilegwkkrleniwdetplyfapsslfdlnfqagflmkkev
qdeeknkkfglsvghhlgksiptdnqikark

SCOPe Domain Coordinates for d4cf6b_:

Click to download the PDB-style file with coordinates for d4cf6b_.
(The format of our PDB-style files is described here.)

Timeline for d4cf6b_: