Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) |
Family c.26.1.4: Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) [63976] (2 proteins) contains C-terminal subdomain similar to one structural repeat of the Creatinase/aminopeptidase family automatically mapped to Pfam PF02569 |
Protein automated matches [191096] (2 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:1773] [259203] (1 PDB entry) |
Domain d4mq6a_: 4mq6 A: [259204] automated match to d3ivca_ complexed with 29w, edo, eoh |
PDB Entry: 4mq6 (more details), 1.7 Å
SCOPe Domain Sequences for d4mq6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mq6a_ c.26.1.4 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} ipafhpgelnvysapgdvadvsralrltgrrvmlvptmgalheghlalvraakrvpgsvv vvsifvnpmqfgaggdldayprtpdddlaqlraegveiaftpttaamypdglrttvqpgp laaeleggprpthfagvltvvlkllqivrpdrvffgekdyqqlvlirqlvadfnldvavv gvptvreadglamssrnryldpaqraaavalsaaltaaahaatagaqaaldaaravldaa pgvavdylelrdiglgpmplngsgrllvaarlgttrlldniaieigtfa
Timeline for d4mq6a_: