Lineage for d4mq6a_ (4mq6 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2468308Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2468309Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2468907Family c.26.1.4: Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) [63976] (2 proteins)
    contains C-terminal subdomain similar to one structural repeat of the Creatinase/aminopeptidase family
    automatically mapped to Pfam PF02569
  6. 2469018Protein automated matches [191096] (2 species)
    not a true protein
  7. 2469019Species Mycobacterium tuberculosis [TaxId:1773] [259203] (1 PDB entry)
  8. 2469020Domain d4mq6a_: 4mq6 A: [259204]
    automated match to d3ivca_
    complexed with 29w, edo, eoh

Details for d4mq6a_

PDB Entry: 4mq6 (more details), 1.7 Å

PDB Description: pantothenate synthase in complex with 2-(5-methoxy-2-(tosylcarbamoyl)- 1h-indol-1-yl)acetic acid
PDB Compounds: (A:) Pantothenate synthetase

SCOPe Domain Sequences for d4mq6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mq6a_ c.26.1.4 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
ipafhpgelnvysapgdvadvsralrltgrrvmlvptmgalheghlalvraakrvpgsvv
vvsifvnpmqfgaggdldayprtpdddlaqlraegveiaftpttaamypdglrttvqpgp
laaeleggprpthfagvltvvlkllqivrpdrvffgekdyqqlvlirqlvadfnldvavv
gvptvreadglamssrnryldpaqraaavalsaaltaaahaatagaqaaldaaravldaa
pgvavdylelrdiglgpmplngsgrllvaarlgttrlldniaieigtfa

SCOPe Domain Coordinates for d4mq6a_:

Click to download the PDB-style file with coordinates for d4mq6a_.
(The format of our PDB-style files is described here.)

Timeline for d4mq6a_: