Lineage for d4lq2a_ (4lq2 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2913609Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
    has additional insertions and/or extensions that are not grouped together
  6. 2914680Protein automated matches [190140] (37 species)
    not a true protein
  7. 2914928Species Salmonella enterica [TaxId:99287] [227690] (7 PDB entries)
  8. 2914936Domain d4lq2a_: 4lq2 A: [259197]
    automated match to d4gxaa_
    protein/DNA complex; complexed with oas

Details for d4lq2a_

PDB Entry: 4lq2 (more details), 2.69 Å

PDB Description: Crystal structure of ligand binding domain of CysB, a LysR member from Salmonella typhimurium in complex with effector ligand, O-acetylserine
PDB Compounds: (A:) HTH-type transcriptional regulator CysB

SCOPe Domain Sequences for d4lq2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lq2a_ c.94.1.1 (A:) automated matches {Salmonella enterica [TaxId: 99287]}
ehtwpdkgslyiatthtqaryalpgvikgfieryprvslhmhqgsptqiaeavskgnadf
aiatealhlyddlvmlpcyhwnrsivvtpdhplaatssvtiealaqyplvtytfgftgrs
eldtafnragltprivftatdadviktyvrlglgvgviasmavdpladpdlvridahdif
shsttkigfrrstflrsymydfiqrfaphltrdvvdtavalrsneeieamfqdiklpek

SCOPe Domain Coordinates for d4lq2a_:

Click to download the PDB-style file with coordinates for d4lq2a_.
(The format of our PDB-style files is described here.)

Timeline for d4lq2a_: